PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_5E49D47AF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 129aa    MW: 14676.8 Da    PI: 10.1852
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_5E49D47AF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.99.5e-183279148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT eEd ll  +++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  Traes_3AS_5E49D47AF.1 32 RGPWTLEEDNLLMSYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 79
                           89*********************************************7 PP

2Myb_DNA-binding52.88.9e-1785128146
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            rg+ T+eE++ ++++++++G++ W++Ia++++ gRt++++k++w++
  Traes_3AS_5E49D47AF.1  85 RGNLTAEEQLVILELHAKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 128
                            7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.792779IPR017930Myb domain
SuperFamilySSF466893.56E-3130126IPR009057Homeodomain-like
SMARTSM007172.2E-133181IPR001005SANT/Myb domain
PfamPF002491.5E-153279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-243386IPR009057Homeodomain-like
CDDcd001673.17E-93479No hitNo description
PROSITE profilePS5129425.02880129IPR017930Myb domain
SMARTSM007175.0E-1084129IPR001005SANT/Myb domain
PfamPF002492.9E-1585128IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-2387129IPR009057Homeodomain-like
CDDcd001674.91E-1089128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MSRRKGAAAA GGGGAGPMEM AAMEEEAAEL RRGPWTLEED NLLMSYIACH GEGRWNLLAR  60
CSGLKRTGKS CRLRWLNYLK PDIKRGNLTA EEQLVILELH AKWGNRWSRI AQHLPGRTDN  120
EIKNYWRTR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A8e-2729128199MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-262912824122MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-105HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754278.13e-70PREDICTED: transcription factor AS1-like
SwissprotQ9LK952e-59MYB21_ARATH; Transcription factor MYB21
TrEMBLM7Y9934e-89M7Y993_TRIUA; Transcription factor MYB21
TrEMBLW5CKK55e-90W5CKK5_WHEAT; Uncharacterized protein
STRINGORGLA01G0016500.19e-70(Oryza glaberrima)
STRINGBGIOSGA002469-PA1e-69(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.13e-59myb domain protein 62
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]